Lineage for d1bq3b_ (1bq3 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72656Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 72657Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 72658Family c.60.1.1: Phosphoglycerate mutase (cofactor-dependent) [53255] (1 protein)
  6. 72659Protein Phosphoglycerate mutase (cofactor-dependent) [53256] (3 species)
  7. 72660Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 72680Domain d1bq3b_: 1bq3 B: [33979]

Details for d1bq3b_

PDB Entry: 1bq3 (more details), 2.7 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate

SCOP Domain Sequences for d1bq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq3b_ c.60.1.1 (B:) Phosphoglycerate mutase (cofactor-dependent) {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa

SCOP Domain Coordinates for d1bq3b_:

Click to download the PDB-style file with coordinates for d1bq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1bq3b_: