Lineage for d1bq3a_ (1bq3 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. Protein Phosphoglycerate mutase [53256] (6 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. Domain d1bq3a_: 1bq3 A: [33978]
    complexed with ihp, so4

Details for d1bq3a_

PDB Entry: 1bq3 (more details), 2.7 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate
PDB Compounds: (A:) protein (phosphoglycerate mutase 1)

SCOPe Domain Sequences for d1bq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq3a_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa

SCOPe Domain Coordinates for d1bq3a_ are not available.

Timeline for d1bq3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bq3b_, d1bq3c_, d1bq3d_