SCOPe 2.06: Domain d5h09a2: 5h09 A:147-249

Lineage for d5h09a2 (5h09 A:147-249)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)

8. Domain d5h09a2: 5h09 A:147-249 [339778]
   Other proteins in same PDB: d5h09a1, d5h09a3, d5h09a4
   automated match to d1qcfa2
   complexed with ooo

Details for d5h09a2

PDB Entry: 5h09, 1.95 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-ethyl2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-4-methylpentanoate

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h09a2:

Sequence; same for both SEQRES and ATOM records:

>d5h09a2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d5h09a2:

• d5h09a2 is new in SCOPe 2.06-stable
  
• d5h09a2 appears in SCOPe 2.07
  
• d5h09a2 appears in the current release, SCOPe 2.08