SCOPe 2.08: Domain d5gz0a2: 5gz0 A:107-213

Lineage for d5gz0a2 (5gz0 A:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Homo sapiens/mus [TaxId:1383439] [326991] (2 PDB entries)

8. Domain d5gz0a2: 5gz0 A:107-213 [339770]
   Other proteins in same PDB: d5gz0a1, d5gz0b_, d5gz0c1, d5gz0d_
   automated match to d1dn0a2

Details for d5gz0a2

PDB Entry: 5gz0, 1.7 Å

PDB Description: crystal structure of fm329, a recombinant fab adopted from cetuximab

PDB Compounds: (A:) FM329 light chain

SCOPe Domain Sequences for d5gz0a2:

Sequence; same for both SEQRES and ATOM records:

>d5gz0a2 b.1.1.2 (A:107-213) automated matches {Homo sapiens/mus [TaxId: 1383439]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

Timeline for d5gz0a2:

• d5gz0a2 first appeared in SCOPe 2.06
  
• d5gz0a2 appears in SCOPe 2.07