Lineage for d5h0ha2 (5h0h A:147-249)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965473Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2965474Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2965476Domain d5h0ha2: 5h0h A:147-249 [339766]
    Other proteins in same PDB: d5h0ha1, d5h0ha3, d5h0ha4
    automated match to d1qcfa2
    complexed with oov

Details for d5h0ha2

PDB Entry: 5h0h (more details), 1.72 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-n,n,4-trimethylpentanamide
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0ha2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d5h0ha2:

Click to download the PDB-style file with coordinates for d5h0ha2.
(The format of our PDB-style files is described here.)

Timeline for d5h0ha2: