SCOPe 2.08: Domain d5gz0c1: 5gz0 C:1-106

Lineage for d5gz0c1 (5gz0 C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Homo sapiens/mus [TaxId:1383439] [326989] (2 PDB entries)

8. Domain d5gz0c1: 5gz0 C:1-106 [339761]
   Other proteins in same PDB: d5gz0a2, d5gz0c2
   automated match to d1dn0a1

Details for d5gz0c1

PDB Entry: 5gz0, 1.7 Å

PDB Description: crystal structure of fm329, a recombinant fab adopted from cetuximab

PDB Compounds: (C:) FM329 light chain

SCOPe Domain Sequences for d5gz0c1:

Sequence; same for both SEQRES and ATOM records:

>d5gz0c1 b.1.1.0 (C:1-106) automated matches {Homo sapiens/mus [TaxId: 1383439]}
diqmtqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklel

Timeline for d5gz0c1:

• d5gz0c1 first appeared in SCOPe 2.06
  
• d5gz0c1 appears in SCOPe 2.07