Lineage for d5gzpa_ (5gzp A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2413230Protein Triosephosphate isomerase [51353] (20 species)
  7. 2413311Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries)
    Uniprot Q07412
  8. 2413366Domain d5gzpa_: 5gzp A: [339758]
    automated match to d4yxgb_
    complexed with edo, pga; mutant

Details for d5gzpa_

PDB Entry: 5gzp (more details), 2.03 Å

PDB Description: y74cox mutant of plasmodium falciparum triosephosphate isomerase
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5gzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzpa_ c.1.1.1 (A:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
diiksam

SCOPe Domain Coordinates for d5gzpa_:

Click to download the PDB-style file with coordinates for d5gzpa_.
(The format of our PDB-style files is described here.)

Timeline for d5gzpa_: