Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Coxsackievirus a6 [TaxId:86107] [339715] (1 PDB entry) |
Domain d5xs4a1: 5xs4 A:71-290 [339741] Other proteins in same PDB: d5xs4c_ automated match to d5abja_ |
PDB Entry: 5xs4 (more details), 3.1 Å
SCOPe Domain Sequences for d5xs4a1:
Sequence, based on SEQRES records: (download)
>d5xs4a1 b.121.4.0 (A:71-290) automated matches {Coxsackievirus a6 [TaxId: 86107]} vneasvehfysraglvgvvevkdsgtsldgytvwpidvmgfvqqrrklelstymrfdaef tfvsnlsnsttpgmllqymyvppgapkpdgrksyqwqtatnpsvfaklsdpppqvsvpfm spatayqwfydgyptfgehkqatnlqygqcpnnmmghfairtvsesttgknvhvrvymri khvrawvprplrsqaymvknyptysqtitntatdrasitt
>d5xs4a1 b.121.4.0 (A:71-290) automated matches {Coxsackievirus a6 [TaxId: 86107]} vneasvehfysraglvgvvevkdsgtsldgytvwpidvmgfvqqrrklelstymrfdaef tfvsnlsnsttpgmllqymyvppgapkpdgrksyqwqtatnpsvfaklsdpppqvsvpfm spatayqwfydgyptnlqygqcpnnmmghfairtvsesttgknvhvrvymrikhvrawvp rplrsqaymvknyptysqtitntatdrasitt
Timeline for d5xs4a1: