SCOP 1.61: Domain d1bq4a_: 1bq4 A:

Lineage for d1bq4a_ (1bq4 A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)

6. Protein Phosphoglycerate mutase [53256] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)

8. Domain d1bq4a_: 1bq4 A: [33974]

Details for d1bq4a_

PDB Entry: 1bq4, 2.5 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate

SCOP Domain Sequences for d1bq4a_:

Sequence; same for both SEQRES and ATOM records:

>d1bq4a_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa

Timeline for d1bq4a_:

• d1bq4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bq4a_ appears in SCOP 1.59
  
• d1bq4a_ appears in SCOP 1.63
  
• d1bq4a_ appears in the current release, SCOPe 2.08