Lineage for d1bq4a_ (1bq4 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183050Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 183051Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 183052Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)
  6. 183058Protein Phosphoglycerate mutase [53256] (3 species)
  7. 183059Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 183074Domain d1bq4a_: 1bq4 A: [33974]

Details for d1bq4a_

PDB Entry: 1bq4 (more details), 2.5 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate

SCOP Domain Sequences for d1bq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq4a_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa

SCOP Domain Coordinates for d1bq4a_:

Click to download the PDB-style file with coordinates for d1bq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bq4a_: