| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
| Domain d5xltc2: 5xlt C:246-440 [339731] Other proteins in same PDB: d5xlta1, d5xltb1, d5xltc1, d5xltd1, d5xlte_, d5xltf1, d5xltf2, d5xltf3 automated match to d4i50a2 complexed with 89o, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5xlt (more details), 2.81 Å
SCOPe Domain Sequences for d5xltc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xltc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv
Timeline for d5xltc2: