Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Bacillus megaterium [TaxId:592022] [323682] (5 PDB entries) |
Domain d5ofqa_: 5ofq A: [339723] automated match to d4rm4a_ complexed with 1pe, hem, so4 |
PDB Entry: 5ofq (more details), 2.7 Å
SCOPe Domain Sequences for d5ofqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofqa_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]} ipmqeiksveqqlypfdiynslrqeapirydesrncwdvfdyetvkyilknpslfsskra meerqesilmmdppkhtklrnlvnkaftpraiqhleghieeiadylldevsskekfdive dfagplpiiviaellgvpiqdralfkkysddlvsgaennsdeafakmmqkrnegviflqg yfkeiiaerqqnkqedlisllleaeidgehlteeevlgfcilllvagnetttnlitngvr ymtedvdvqnevrrdislvpnlveetlryyppiqaigriaaedvelgeckikrgqqvisw aasanrdsakfewpdtfvvhrktnphvsfgfgihfclgaplarmegkiaftkllekggfs kvqnqslkpidspfvfgvkkyeiafn
Timeline for d5ofqa_: