Lineage for d4pgmc_ (4pgm C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2890977Protein Phosphoglycerate mutase [53256] (6 species)
  7. 2890978Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 2890991Domain d4pgmc_: 4pgm C: [33972]

Details for d4pgmc_

PDB Entry: 4pgm (more details), 2.3 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase
PDB Compounds: (C:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d4pgmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pgmc_ c.60.1.1 (C:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa

SCOPe Domain Coordinates for d4pgmc_:

Click to download the PDB-style file with coordinates for d4pgmc_.
(The format of our PDB-style files is described here.)

Timeline for d4pgmc_: