SCOPe 2.08: Domain d5xd9a1: 5xd9 A:1-130

Lineage for d5xd9a1 (5xd9 A:1-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Vibrio sp. [TaxId:1116375] [339693] (3 PDB entries)

8. Domain d5xd9a1: 5xd9 A:1-130 [339718]
   Other proteins in same PDB: d5xd9a2
   automated match to d2ovla1
   complexed with mg

Details for d5xd9a1

PDB Entry: 5xd9, 2.6 Å

PDB Description: crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase

PDB Compounds: (A:) 3,6-anhydro-alpha-L-galactonate cycloisomerase

SCOPe Domain Sequences for d5xd9a1:

Sequence; same for both SEQRES and ATOM records:

>d5xd9a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]}
mkttikdiktrlfkiplkeilsdakhgdhdhfelitttvtledgsqgtgytytggkggys
ikamleydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkre
glplwkmagg

Timeline for d5xd9a1:

• d5xd9a1 first appeared in SCOPe 2.06
  
• d5xd9a1 appears in SCOPe 2.07