![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Vibrio sp. [TaxId:1116375] [339693] (3 PDB entries) |
![]() | Domain d5xd9a1: 5xd9 A:1-130 [339718] Other proteins in same PDB: d5xd9a2 automated match to d2ovla1 complexed with mg |
PDB Entry: 5xd9 (more details), 2.6 Å
SCOPe Domain Sequences for d5xd9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xd9a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]} mkttikdiktrlfkiplkeilsdakhgdhdhfelitttvtledgsqgtgytytggkggys ikamleydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkre glplwkmagg
Timeline for d5xd9a1: