Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries) |
Domain d5xlte_: 5xlt E: [339707] Other proteins in same PDB: d5xlta1, d5xlta2, d5xltb1, d5xltb2, d5xltc1, d5xltc2, d5xltd1, d5xltd2, d5xltf1, d5xltf2, d5xltf3 automated match to d4i55e_ complexed with 89o, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5xlt (more details), 2.81 Å
SCOPe Domain Sequences for d5xlte_:
Sequence, based on SEQRES records: (download)
>d5xlte_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5xlte_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5xlte_: