Lineage for d5xd8a2 (5xd8 A:131-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837886Species Vibrio sp. [TaxId:1116375] [339695] (3 PDB entries)
  8. 2837888Domain d5xd8a2: 5xd8 A:131-362 [339701]
    Other proteins in same PDB: d5xd8a1, d5xd8a3, d5xd8b1, d5xd8b3
    automated match to d2ovld2
    complexed with mg

Details for d5xd8a2

PDB Entry: 5xd8 (more details), 2.51 Å

PDB Description: crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase
PDB Compounds: (A:) 3,6-anhydro-alpha-L-galactonate cycloisomerase

SCOPe Domain Sequences for d5xd8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xd8a2 c.1.11.0 (A:131-362) automated matches {Vibrio sp. [TaxId: 1116375]}
knntckaycggidlqfplekllnnicgylesgfnavkikigrenmqedidrikavrelig
pditfmidanysltveqaiklskaveqyditwfeeptlpddykgfaeiadntaiplamge
nlhtihefgyamdqaklgycqpdasncggitgwlkaadlitehnipvcthgmqelhvslv
safdtgwlevhsfpideytkrplvvenfravasnepgigvefdwdkiaqyev

SCOPe Domain Coordinates for d5xd8a2:

Click to download the PDB-style file with coordinates for d5xd8a2.
(The format of our PDB-style files is described here.)

Timeline for d5xd8a2: