| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Vibrio sp. [TaxId:1116375] [339695] (3 PDB entries) |
| Domain d5xd8a2: 5xd8 A:131-362 [339701] Other proteins in same PDB: d5xd8a1, d5xd8a3, d5xd8b1, d5xd8b3 automated match to d2ovld2 complexed with mg |
PDB Entry: 5xd8 (more details), 2.51 Å
SCOPe Domain Sequences for d5xd8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xd8a2 c.1.11.0 (A:131-362) automated matches {Vibrio sp. [TaxId: 1116375]}
knntckaycggidlqfplekllnnicgylesgfnavkikigrenmqedidrikavrelig
pditfmidanysltveqaiklskaveqyditwfeeptlpddykgfaeiadntaiplamge
nlhtihefgyamdqaklgycqpdasncggitgwlkaadlitehnipvcthgmqelhvslv
safdtgwlevhsfpideytkrplvvenfravasnepgigvefdwdkiaqyev
Timeline for d5xd8a2: