| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Vibrio sp. [TaxId:1116375] [339693] (3 PDB entries) |
| Domain d5xd8a1: 5xd8 A:1-130 [339700] Other proteins in same PDB: d5xd8a2, d5xd8a3, d5xd8b2, d5xd8b3 automated match to d2ovla1 complexed with mg |
PDB Entry: 5xd8 (more details), 2.51 Å
SCOPe Domain Sequences for d5xd8a1:
Sequence, based on SEQRES records: (download)
>d5xd8a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]}
mkttikdiktrlfkiplkeilsdakhgdhdhfelitttvtledgsqgtgytytggkggys
ikamleydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkre
glplwkmagg
>d5xd8a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]}
mkttikdiktrlfkiplkdhfelitttvtledgsqgtgytytggkggysikamleydiqp
aligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkreglplwkmagg
Timeline for d5xd8a1: