Lineage for d5xltb2 (5xlt B:244-428)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2566364Domain d5xltb2: 5xlt B:244-428 [339699]
    Other proteins in same PDB: d5xlta1, d5xltb1, d5xltc1, d5xltd1, d5xlte_, d5xltf1, d5xltf2, d5xltf3
    automated match to d3rycd2
    complexed with 89o, acp, ca, gdp, gtp, mes, mg

Details for d5xltb2

PDB Entry: 5xlt (more details), 2.81 Å

PDB Description: the crystal structure of tubulin in complex with 4'- demethylepipodophyllotoxin
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xltb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xltb2 d.79.2.1 (B:244-428) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d5xltb2:

Click to download the PDB-style file with coordinates for d5xltb2.
(The format of our PDB-style files is described here.)

Timeline for d5xltb2: