| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
| Domain d5xltb1: 5xlt B:2-243 [339698] Other proteins in same PDB: d5xlta2, d5xltb2, d5xltc2, d5xltd2, d5xlte_, d5xltf1, d5xltf2, d5xltf3 automated match to d4drxb1 complexed with 89o, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5xlt (more details), 2.81 Å
SCOPe Domain Sequences for d5xltb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xltb1 c.32.1.1 (B:2-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp
Timeline for d5xltb1: