Lineage for d5xd7a1 (5xd7 A:1-130)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192287Species Vibrio sp. [TaxId:1116375] [339693] (3 PDB entries)
  8. 2192288Domain d5xd7a1: 5xd7 A:1-130 [339694]
    Other proteins in same PDB: d5xd7a2, d5xd7a3
    automated match to d2ovla1
    complexed with acy, mg

Details for d5xd7a1

PDB Entry: 5xd7 (more details), 2.2 Å

PDB Description: crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase
PDB Compounds: (A:) 3,6-anhydro-alpha-L-galactonate cycloisomerase

SCOPe Domain Sequences for d5xd7a1:

Sequence, based on SEQRES records: (download)

>d5xd7a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]}
mkttikdiktrlfkiplkeilsdakhgdhdhfelitttvtledgsqgtgytytggkggys
ikamleydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkre
glplwkmagg

Sequence, based on observed residues (ATOM records): (download)

>d5xd7a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]}
mkttikdiktrlfkiplkeilsdhdhfelitttvtledgsqgtgytytggkggysikaml
eydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkreglplw
kmagg

SCOPe Domain Coordinates for d5xd7a1:

Click to download the PDB-style file with coordinates for d5xd7a1.
(The format of our PDB-style files is described here.)

Timeline for d5xd7a1: