Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Vibrio sp. [TaxId:1116375] [339693] (3 PDB entries) |
Domain d5xd7a1: 5xd7 A:1-130 [339694] Other proteins in same PDB: d5xd7a2, d5xd7a3 automated match to d2ovla1 complexed with acy, mg |
PDB Entry: 5xd7 (more details), 2.2 Å
SCOPe Domain Sequences for d5xd7a1:
Sequence, based on SEQRES records: (download)
>d5xd7a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]} mkttikdiktrlfkiplkeilsdakhgdhdhfelitttvtledgsqgtgytytggkggys ikamleydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkre glplwkmagg
>d5xd7a1 d.54.1.0 (A:1-130) automated matches {Vibrio sp. [TaxId: 1116375]} mkttikdiktrlfkiplkeilsdhdhfelitttvtledgsqgtgytytggkggysikaml eydiqpaligkdatqieeiydfmewhihyvgrggistfamsavdialwdlkgkreglplw kmagg
Timeline for d5xd7a1: