Lineage for d5w8ta1 (5w8t A:2-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933397Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311415] (6 PDB entries)
  8. 2933404Domain d5w8ta1: 5w8t A:2-61 [339683]
    Other proteins in same PDB: d5w8ta2, d5w8tc2
    automated match to d4pt5a1
    complexed with aye, mpd, zn

Details for d5w8ta1

PDB Entry: 5w8t (more details), 2.76 Å

PDB Description: crystal structure of mers-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (A:) ORF1ab

SCOPe Domain Sequences for d5w8ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w8ta1 d.15.1.0 (A:2-61) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

SCOPe Domain Coordinates for d5w8ta1:

Click to download the PDB-style file with coordinates for d5w8ta1.
(The format of our PDB-style files is described here.)

Timeline for d5w8ta1: