Lineage for d5vz4a_ (5vz4 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260706Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2260707Protein automated matches [190506] (3 species)
    not a true protein
  7. 2260708Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries)
  8. 2260729Domain d5vz4a_: 5vz4 A: [339680]
    automated match to d2qcqb_
    complexed with br, edo, so4

Details for d5vz4a_

PDB Entry: 5vz4 (more details), 2.2 Å

PDB Description: receptor-growth factor crystal structure at 2.20 angstrom resolution
PDB Compounds: (A:) Growth/differentiation factor 15

SCOPe Domain Sequences for d5vz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vz4a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhcplgpgrccrlhtvrasledlgwadwvlsprevqvtmcigacpsqfraanmhaqikts
lhrlkpdtvpapccvpasynpmvliqktdtgvslqtyddllakdchci

SCOPe Domain Coordinates for d5vz4a_:

Click to download the PDB-style file with coordinates for d5vz4a_.
(The format of our PDB-style files is described here.)

Timeline for d5vz4a_: