Lineage for d5vmpc_ (5vmp C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404954Family b.82.2.14: Histone demethylase core [254153] (4 protein domains)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2404958Protein JMJD2A core [254342] (1 species)
  7. 2404959Species Human (Homo sapiens) [TaxId:9606] [254775] (41 PDB entries)
  8. 2405051Domain d5vmpc_: 5vmp C: [339678]
    automated match to d4v2wb_
    complexed with 9fj, ni, zn

Details for d5vmpc_

PDB Entry: 5vmp (more details), 2.48 Å

PDB Description: crystal structure of human kdm4 with small molecule inhibitor qc5714
PDB Compounds: (C:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5vmpc_:

Sequence, based on SEQRES records: (download)

>d5vmpc_ b.82.2.14 (C:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
arimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipapi
qqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltfnppi
ygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfawhted
mdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplmlk
kygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrkd
mvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl

Sequence, based on observed residues (ATOM records): (download)

>d5vmpc_ b.82.2.14 (C:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
arimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipapi
qqlvtgqsglftqyniqkkamtvrefrkiansdkyctpryfeelerkywknltfnppiyg
advngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfawhtedmd
lysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplmlkky
gipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrkism
dvfvrkfqperyklwkagktvidhtlptpeaaefl

SCOPe Domain Coordinates for d5vmpc_:

Click to download the PDB-style file with coordinates for d5vmpc_.
(The format of our PDB-style files is described here.)

Timeline for d5vmpc_: