Lineage for d4uixc1 (4uix C:44-163)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (712 PDB entries)
  8. 2317251Domain d4uixc1: 4uix C:44-163 [339676]
    Other proteins in same PDB: d4uixa2, d4uixb2, d4uixc2
    automated match to d4hbwa_
    complexed with ca, edo, tvu

Details for d4uixc1

PDB Entry: 4uix (more details), 1.58 Å

PDB Description: n-terminal bromodomain of human brd4 with 7-(3,4-dimethoxyphenyl)-n- (1,1-dioxo-1-thian-4-yl)-5-methyl-4-oxo-4h,5h-thieno-3,2-c-pyridine- 2- carboxamide
PDB Compounds: (C:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d4uixc1:

Sequence, based on SEQRES records: (download)

>d4uixc1 a.29.2.0 (C:44-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nppppetsnpnkpkrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykiikt
pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine

Sequence, based on observed residues (ATOM records): (download)

>d4uixc1 a.29.2.0 (C:44-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nppppetrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykiiktpmdmgti
kkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine

SCOPe Domain Coordinates for d4uixc1:

Click to download the PDB-style file with coordinates for d4uixc1.
(The format of our PDB-style files is described here.)

Timeline for d4uixc1: