Lineage for d5vz3a_ (5vz3 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033955Domain d5vz3a_: 5vz3 A: [339667]
    automated match to d2qcqb_

Details for d5vz3a_

PDB Entry: 5vz3 (more details), 1.97 Å

PDB Description: growth factor crystal structure at 1.97 angstrom resolution
PDB Compounds: (A:) Growth/differentiation factor 15

SCOPe Domain Sequences for d5vz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vz3a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhcplgpgrccrlhtvrasledlgwadwvlsprevqvtmcigacpsqfraanmhaqikts
lhrlkpdtvpapccvpasynpmvliqktdtgvslqtyddllakdchci

SCOPe Domain Coordinates for d5vz3a_:

Click to download the PDB-style file with coordinates for d5vz3a_.
(The format of our PDB-style files is described here.)

Timeline for d5vz3a_: