Lineage for d5up9d_ (5up9 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 2313377Protein automated matches [190041] (29 species)
    not a true protein
  7. 2313645Species Human (Homo sapiens) [TaxId:9606] [187027] (28 PDB entries)
  8. 2313681Domain d5up9d_: 5up9 D: [339658]
    automated match to d4ml5a_
    complexed with byx, peg, pge, zn

Details for d5up9d_

PDB Entry: 5up9 (more details), 2.45 Å

PDB Description: crystal structure of zn-bound human heavy-chain ferritin variant 122h- delta c-star with para-xylenedihydroxamate
PDB Compounds: (D:) ferritin heavy chain

SCOPe Domain Sequences for d5up9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5up9d_ a.25.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahdk
ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd

SCOPe Domain Coordinates for d5up9d_:

Click to download the PDB-style file with coordinates for d5up9d_.
(The format of our PDB-style files is described here.)

Timeline for d5up9d_: