Lineage for d5pgmd_ (5pgm D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25777Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 25778Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 25779Family c.60.1.1: Phosphoglycerate mutase [53255] (1 protein)
  6. 25780Protein Phosphoglycerate mutase [53256] (1 species)
  7. 25781Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 25787Domain d5pgmd_: 5pgm D: [33965]

Details for d5pgmd_

PDB Entry: 5pgm (more details), 2.12 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase

SCOP Domain Sequences for d5pgmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pgmd_ c.60.1.1 (D:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa

SCOP Domain Coordinates for d5pgmd_:

Click to download the PDB-style file with coordinates for d5pgmd_.
(The format of our PDB-style files is described here.)

Timeline for d5pgmd_: