Lineage for d5tvqb_ (5tvq B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931492Protein SUMO-2 [117816] (1 species)
  7. 2931493Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries)
    Uniprot P61956
  8. 2931499Domain d5tvqb_: 5tvq B: [339636]
    automated match to d2awta_
    protein/DNA complex; complexed with act, ca

Details for d5tvqb_

PDB Entry: 5tvq (more details), 2.35 Å

PDB Description: mouse tdp2 catalytic domain bound to sumo2
PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d5tvqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tvqb_ d.15.1.1 (B:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
nndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtp
aqlemededtidvfq

SCOPe Domain Coordinates for d5tvqb_:

Click to download the PDB-style file with coordinates for d5tvqb_.
(The format of our PDB-style files is described here.)

Timeline for d5tvqb_: