Lineage for d5td9a2 (5td9 A:141-434)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2422501Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2422502Family c.1.11.1: Enolase [51605] (2 protein domains)
    automatically mapped to Pfam PF00113
  6. 2422503Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2422547Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
    Uniprot P09104
  8. 2422578Domain d5td9a2: 5td9 A:141-434 [339610]
    Other proteins in same PDB: d5td9a1, d5td9b1
    automated match to d2akza1
    complexed with cl, mg

Details for d5td9a2

PDB Entry: 5td9 (more details), 2.32 Å

PDB Description: structure of human enolase 2
PDB Compounds: (A:) Gamma-enolase

SCOPe Domain Sequences for d5td9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5td9a2 c.1.11.1 (A:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOPe Domain Coordinates for d5td9a2:

Click to download the PDB-style file with coordinates for d5td9a2.
(The format of our PDB-style files is described here.)

Timeline for d5td9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5td9a1