| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
| Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
| Protein Phosphoglycerate mutase [53256] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries) |
| Domain d1qhfb_: 1qhf B: [33961] complexed with 3pg, so4 |
PDB Entry: 1qhf (more details), 1.7 Å
SCOPe Domain Sequences for d1qhfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhfb_ c.60.1.1 (B:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav
Timeline for d1qhfb_: