Lineage for d5o0wh1 (5o0w H:6-135)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745605Domain d5o0wh1: 5o0w H:6-135 [339606]
    Other proteins in same PDB: d5o0wa_, d5o0wb_, d5o0wc_, d5o0wd_, d5o0we2, d5o0we3, d5o0wf2, d5o0wf3, d5o0wg2, d5o0wg3, d5o0wh2, d5o0wh3
    automated match to d4dkaa_
    complexed with gol

Details for d5o0wh1

PDB Entry: 5o0w (more details), 2.57 Å

PDB Description: crystal structure of the complex between nb474 and trypanosoma congolense fructose-1,6-bisphosphate aldolase
PDB Compounds: (H:) Nb474

SCOPe Domain Sequences for d5o0wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o0wh1 b.1.1.1 (H:6-135) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgartdya
dsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctissdtyd
ywgqgtqvtv

SCOPe Domain Coordinates for d5o0wh1:

Click to download the PDB-style file with coordinates for d5o0wh1.
(The format of our PDB-style files is described here.)

Timeline for d5o0wh1: