Lineage for d1qhfa_ (1qhf A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125227Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 125228Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 125229Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)
  6. 125233Protein Phosphoglycerate mutase [53256] (3 species)
  7. 125234Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 125235Domain d1qhfa_: 1qhf A: [33960]

Details for d1qhfa_

PDB Entry: 1qhf (more details), 1.7 Å

PDB Description: yeast phosphoglycerate mutase-3pg complex structure to 1.7 a

SCOP Domain Sequences for d1qhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav

SCOP Domain Coordinates for d1qhfa_:

Click to download the PDB-style file with coordinates for d1qhfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qhfa_: