SCOPe 2.04: Domain d1fgsa1: 1fgs A:297-425

Lineage for d1fgsa1 (1fgs A:297-425)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families)

5. Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)

6. Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)

7. Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries)

8. Domain d1fgsa1: 1fgs A:297-425 [33959]
   Other proteins in same PDB: d1fgsa2
   complexed with mg, pop

Details for d1fgsa1

PDB Entry: 1fgs, 2.4 Å

PDB Description: folylpolyglutamate synthetase from lactobacillus casei

PDB Compounds: (A:) folylpolyglutamate synthetase

SCOPe Domain Sequences for d1fgsa1:

Sequence, based on SEQRES records:

>d1fgsa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg

Sequence, based on observed residues (ATOM records):

>d1fgsa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagyaamadrltaafstv
ylvpvpgtprgrlkdswqealaaslndvpdqpivitgslylasavrqtllg

Timeline for d1fgsa1:

• d1fgsa1 first appeared (with stable ids) in SCOP 1.55, called d1fgs_1
  
• d1fgsa1 appears in SCOPe 2.03
  
• d1fgsa1 appears in SCOPe 2.05
  
• d1fgsa1 appears in the current release, SCOPe 2.08