Lineage for d1fgsa1 (1fgs A:297-425)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174742Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1174743Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 1174778Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)
  6. 1174779Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)
  7. 1174780Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries)
  8. 1174787Domain d1fgsa1: 1fgs A:297-425 [33959]
    Other proteins in same PDB: d1fgsa2
    complexed with mg, pop

Details for d1fgsa1

PDB Entry: 1fgs (more details), 2.4 Å

PDB Description: folylpolyglutamate synthetase from lactobacillus casei
PDB Compounds: (A:) folylpolyglutamate synthetase

SCOPe Domain Sequences for d1fgsa1:

Sequence, based on SEQRES records: (download)

>d1fgsa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg

Sequence, based on observed residues (ATOM records): (download)

>d1fgsa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagyaamadrltaafstv
ylvpvpgtprgrlkdswqealaaslndvpdqpivitgslylasavrqtllg

SCOPe Domain Coordinates for d1fgsa1:

Click to download the PDB-style file with coordinates for d1fgsa1.
(The format of our PDB-style files is described here.)

Timeline for d1fgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgsa2