Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) |
Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein) |
Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species) |
Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries) |
Domain d1fgsa1: 1fgs A:297-425 [33959] Other proteins in same PDB: d1fgsa2 complexed with mg, pop |
PDB Entry: 1fgs (more details), 2.4 Å
SCOPe Domain Sequences for d1fgsa1:
Sequence, based on SEQRES records: (download)
>d1fgsa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]} wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla savrqtllg
>d1fgsa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]} wparlekisdtplividgahnpdginglitalkqlfsqpitviagyaamadrltaafstv ylvpvpgtprgrlkdswqealaaslndvpdqpivitgslylasavrqtllg
Timeline for d1fgsa1: