Lineage for d1fgs_1 (1fgs 297-425)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588053Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 588054Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 588084Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)
  6. 588085Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)
  7. 588086Species Lactobacillus casei [TaxId:1582] [53252] (3 PDB entries)
  8. 588089Domain d1fgs_1: 1fgs 297-425 [33959]
    Other proteins in same PDB: d1fgs_2
    complexed with mg, pop

Details for d1fgs_1

PDB Entry: 1fgs (more details), 2.4 Å

PDB Description: folylpolyglutamate synthetase from lactobacillus casei

SCOP Domain Sequences for d1fgs_1:

Sequence, based on SEQRES records: (download)

>d1fgs_1 c.59.1.2 (297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg

Sequence, based on observed residues (ATOM records): (download)

>d1fgs_1 c.59.1.2 (297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagyaamadrltaafstv
ylvpvpgtprgrlkdswqealaaslndvpdqpivitgslylasavrqtllg

SCOP Domain Coordinates for d1fgs_1:

Click to download the PDB-style file with coordinates for d1fgs_1.
(The format of our PDB-style files is described here.)

Timeline for d1fgs_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgs_2