Lineage for d5ofqd_ (5ofq D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331691Species Bacillus megaterium [TaxId:592022] [323682] (5 PDB entries)
  8. 2331703Domain d5ofqd_: 5ofq D: [339588]
    automated match to d4rm4a_
    complexed with 1pe, hem, so4

Details for d5ofqd_

PDB Entry: 5ofq (more details), 2.7 Å

PDB Description: crystal structure of substrate-free cyp109a2 from bacillus megaterium
PDB Compounds: (D:) cytochrome p450

SCOPe Domain Sequences for d5ofqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofqd_ a.104.1.0 (D:) automated matches {Bacillus megaterium [TaxId: 592022]}
lipmqeiksveqqlypfdiynslrqeapirydesrncwdvfdyetvkyilknpslfsskr
ameerqesilmmdppkhtklrnlvnkaftpraiqhleghieeiadylldevsskekfdiv
edfagplpiiviaellgvpiqdralfkkysddlvsgaennsdeafakmmqkrnegviflq
gyfkeiiaerqqnkqedlisllleaeidgehlteeevlgfcilllvagnetttnlitngv
rymtedvdvqnevrrdislvpnlveetlryyppiqaigriaaedvelgeckikrgqqvis
waasanrdsakfewpdtfvvhrktnphvsfgfgihfclgaplarmegkiaftkllekggf
skvqnqslkpidspfvfgvkkyeiafn

SCOPe Domain Coordinates for d5ofqd_:

Click to download the PDB-style file with coordinates for d5ofqd_.
(The format of our PDB-style files is described here.)

Timeline for d5ofqd_: