SCOPe 2.08: Domain d5o5wa_: 5o5w A:

Lineage for d5o5wa_ (5o5w A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:322710] [258948] (19 PDB entries)

8. Domain d5o5wa_: 5o5w A: [339584]
   automated match to d2ogxa_
   complexed with 8m0, atp, m10, mg, mo

Details for d5o5wa_

PDB Entry: 5o5w, 1.7 Å

PDB Description: molybdenum storage protein room-temperature structure determined by serial millisecond crystallography

PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d5o5wa_:

Sequence; same for both SEQRES and ATOM records:

>d5o5wa_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
vrpa

Timeline for d5o5wa_:

• d5o5wa_ first appeared in SCOPe 2.06
  
• d5o5wa_ appears in SCOPe 2.07