Lineage for d1gg4a1 (1gg4 A:313-447)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498723Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2498724Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2498725Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 2498726Protein UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF [53248] (1 species)
  7. 2498727Species Escherichia coli [TaxId:562] [53249] (1 PDB entry)
  8. 2498728Domain d1gg4a1: 1gg4 A:313-447 [33957]
    Other proteins in same PDB: d1gg4a3, d1gg4a4, d1gg4b3, d1gg4b4

Details for d1gg4a1

PDB Entry: 1gg4 (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d- alanine-adding enzyme (murf) at 2.3 angstrom resolution
PDB Compounds: (A:) udp-n-acetylmuramoylalanyl-d-glutamyl-2,6-diaminopimelate-d-alanyl-d-alanyl ligase

SCOPe Domain Sequences for d1gg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg4a1 c.59.1.1 (A:313-447) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]}
vpgrlfpiqlaenqlllddsynanvgsmtaavqvlaempgyrvlvvgdmaelgaeseach
vqvgeaakaagidrvlsvgkqshaistasgvgehfadktalitrlklliaeqqvitilvk
gsrsaameevvralq

SCOPe Domain Coordinates for d1gg4a1:

Click to download the PDB-style file with coordinates for d1gg4a1.
(The format of our PDB-style files is described here.)

Timeline for d1gg4a1: