SCOPe 2.06: Domain d5o8aa1: 5o8a A:1-239

Lineage for d5o8aa1 (5o8a A:1-239)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Human respiratory syncytial virus [TaxId:11250] [339562] (1 PDB entry)

8. Domain d5o8aa1: 5o8a A:1-239 [339563]
   Other proteins in same PDB: d5o8aa2
   automated match to d3st3a_

Details for d5o8aa1

PDB Entry: 5o8a, 1.7 Å

PDB Description: crystal structure of rsegfp2 in the non-fluorescent off-state determined by sfx

PDB Compounds: (A:) M2-1 mGFP fusion protein

SCOPe Domain Sequences for d5o8aa1:

Sequence; same for both SEQRES and ATOM records:

>d5o8aa1 d.22.1.1 (A:1-239) automated matches {Human respiratory syncytial virus [TaxId: 11250]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttlxvlcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngiksnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmdelyk

Timeline for d5o8aa1:

• d5o8aa1 is new in SCOPe 2.06-stable
  
• d5o8aa1 appears in SCOPe 2.07
  
• d5o8aa1 appears in the current release, SCOPe 2.08