Lineage for d5ngga_ (5ngg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996859Species Bradyrhizobium japonicum [TaxId:224911] [226051] (4 PDB entries)
  8. 2996862Domain d5ngga_: 5ngg A: [339545]
    automated match to d3lvzb_
    complexed with act, zn

Details for d5ngga_

PDB Entry: 5ngg (more details), 1.18 Å

PDB Description: crystal structure of the subclass b3 metallo-beta-lactamase bjp-1 in complex with acetate anion
PDB Compounds: (A:) Blr6230 protein

SCOPe Domain Sequences for d5ngga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ngga_ d.157.1.1 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
qtikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmi
kdniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgde
knedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlff
csgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgap
npfikpgelvtyatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d5ngga_:

Click to download the PDB-style file with coordinates for d5ngga_.
(The format of our PDB-style files is described here.)

Timeline for d5ngga_: