![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (16 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries) |
![]() | Domain d5hati2: 5hat I:139-455 [339540] Other proteins in same PDB: d5hata1, d5hatb1, d5hatc1, d5hatd1, d5hate1, d5hatf1, d5hatg1, d5hath1, d5hati1, d5hatj1, d5hatk1, d5hatl1 automated match to d4lf2a2 complexed with cap, mg; mutant |
PDB Entry: 5hat (more details), 2 Å
SCOPe Domain Sequences for d5hati2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hati2 c.1.14.1 (I:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf esfpqdadklypnwrak
Timeline for d5hati2: