SCOPe 2.06: Domain d1uaga2: 1uag A:298-437

Lineage for d1uaga2 (1uag A:298-437)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
7. Species Escherichia coli [TaxId:562] [53247] (7 PDB entries)

8. Domain d1uaga2: 1uag A:298-437 [33954]
   Other proteins in same PDB: d1uaga1, d1uaga3
   complexed with so4, uma

Details for d1uaga2

PDB Entry: 1uag, 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine/:d-glutamate ligase

SCOPe Domain Sequences for d1uaga2:

Sequence; same for both SEQRES and ATOM records:

>d1uaga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

Timeline for d1uaga2:

• d1uaga2 first appeared (with stable ids) in SCOP 1.55, called d1uag_2
  
• d1uaga2 appears in SCOPe 2.05
  
• d1uaga2 appears in SCOPe 2.07
  
• d1uaga2 appears in the current release, SCOPe 2.08