Lineage for d1uag_2 (1uag 298-437)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72631Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
  4. 72632Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 72633Family c.59.1.1: MurD/MurE/MurF C-terminal domain [53245] (3 proteins)
  6. 72638Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 72639Species Escherichia coli [TaxId:562] [53247] (6 PDB entries)
  8. 72643Domain d1uag_2: 1uag 298-437 [33954]
    Other proteins in same PDB: d1uag_1, d1uag_3

Details for d1uag_2

PDB Entry: 1uag (more details), 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1uag_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uag_2 c.59.1.1 (298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOP Domain Coordinates for d1uag_2:

Click to download the PDB-style file with coordinates for d1uag_2.
(The format of our PDB-style files is described here.)

Timeline for d1uag_2: