| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) ![]() |
| Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins) |
| Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species) |
| Species Escherichia coli [TaxId:562] [53247] (6 PDB entries) |
| Domain d4uaga2: 4uag A:298-437 [33952] Other proteins in same PDB: d4uaga1, d4uaga3 complexed with so4, uag, unx |
PDB Entry: 4uag (more details), 1.66 Å
SCOP Domain Sequences for d4uaga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uaga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg
Timeline for d4uaga2: