Lineage for d5jcbd2 (5jcb D:248-441)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201706Species Pig (Sus scrofa) [TaxId:9823] [278816] (9 PDB entries)
  8. 2201714Domain d5jcbd2: 5jcb D:248-441 [339519]
    Other proteins in same PDB: d5jcba1, d5jcbb1, d5jcbc1, d5jcbd1, d5jcbe_, d5jcbf1
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg

Details for d5jcbd2

PDB Entry: 5jcb (more details), 2.3 Å

PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5jcbd2:

Sequence, based on SEQRES records: (download)

>d5jcbd2 d.79.2.1 (D:248-441) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
lnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaacdp
rhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa
tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy
qdatad

Sequence, based on observed residues (ATOM records): (download)

>d5jcbd2 d.79.2.1 (D:248-441) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ladlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltvaai
frgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignstaiqe
lfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5jcbd2:

Click to download the PDB-style file with coordinates for d5jcbd2.
(The format of our PDB-style files is described here.)

Timeline for d5jcbd2: