Lineage for d5jcbd1 (5jcb D:1-245)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (10 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries) 
Domain d5jcbd1: 5jcb D:1-245 [339518]
Other proteins in same PDB: d5jcba2, d5jcbb2, d5jcbc2, d5jcbd2, d5jcbe_, d5jcbf1, d5jcbf2
automated match to d4drxb1
complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg
Details for d5jcbd1
PDB Entry: 5jcb (more details), 2.3 Å
PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (D:) Tubulin beta chainSCOPe Domain Sequences for d5jcbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jcbd1 c.32.1.1 (D:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
SCOPe Domain Coordinates for d5jcbd1:
Click to download the PDB-style file with coordinates for d5jcbd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jcbd1:
View in 3D
