SCOPe 2.08: Domain d5kail_: 5kai L:

Lineage for d5kail_ (5kai L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
   Uniprot Q8DIN8 1-37

8. Domain d5kail_: 5kai L: [339515]
   Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
   automated match to d2axtl1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kail_

PDB Entry: 5kai, 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5kail_:

Sequence; same for both SEQRES and ATOM records:

>d5kail_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d5kail_:

• d5kail_ first appeared in SCOPe 2.06
  
• d5kail_ appears in SCOPe 2.07