Lineage for d5jcbf1 (5jcb F:1-76)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470640Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries)
  8. 2470645Domain d5jcbf1: 5jcb F:1-76 [339510]
    Other proteins in same PDB: d5jcba1, d5jcba2, d5jcbb1, d5jcbb2, d5jcbc1, d5jcbc2, d5jcbd1, d5jcbd2, d5jcbe_, d5jcbf2
    automated match to d3tiia1
    complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg

Details for d5jcbf1

PDB Entry: 5jcb (more details), 2.3 Å

PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5jcbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcbf1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5jcbf1:

Click to download the PDB-style file with coordinates for d5jcbf1.
(The format of our PDB-style files is described here.)

Timeline for d5jcbf1: