| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (39 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries) |
| Domain d5jcbf1: 5jcb F:1-76 [339510] Other proteins in same PDB: d5jcba1, d5jcba2, d5jcbb1, d5jcbb2, d5jcbc1, d5jcbc2, d5jcbd1, d5jcbd2, d5jcbe_, d5jcbf2 automated match to d3tiia1 complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg |
PDB Entry: 5jcb (more details), 2.3 Å
SCOPe Domain Sequences for d5jcbf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jcbf1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas
Timeline for d5jcbf1: