Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein automated matches [317456] (2 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [317457] (3 PDB entries) |
Domain d5jcbe_: 5jcb E: [339505] Other proteins in same PDB: d5jcba1, d5jcba2, d5jcbb1, d5jcbb2, d5jcbc1, d5jcbc2, d5jcbd1, d5jcbd2, d5jcbf1, d5jcbf2 automated match to d4i55e_ complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg |
PDB Entry: 5jcb (more details), 2.3 Å
SCOPe Domain Sequences for d5jcbe_:
Sequence, based on SEQRES records: (download)
>d5jcbe_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5jcbe_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5jcbe_: