Lineage for d5jcbe_ (5jcb E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2347150Protein automated matches [317456] (2 species)
    not a true protein
  7. 2347151Species Pig (Sus scrofa) [TaxId:9823] [317457] (3 PDB entries)
  8. 2347153Domain d5jcbe_: 5jcb E: [339505]
    Other proteins in same PDB: d5jcba1, d5jcba2, d5jcbb1, d5jcbb2, d5jcbc1, d5jcbc2, d5jcbd1, d5jcbd2, d5jcbf1, d5jcbf2
    automated match to d4i55e_
    complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg

Details for d5jcbe_

PDB Entry: 5jcb (more details), 2.3 Å

PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (E:) Stathmin

SCOPe Domain Sequences for d5jcbe_:

Sequence, based on SEQRES records: (download)

>d5jcbe_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5jcbe_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5jcbe_:

Click to download the PDB-style file with coordinates for d5jcbe_.
(The format of our PDB-style files is described here.)

Timeline for d5jcbe_: