Lineage for d5jcbc2 (5jcb C:246-440)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566456Domain d5jcbc2: 5jcb C:246-440 [339504]
    Other proteins in same PDB: d5jcba1, d5jcbb1, d5jcbc1, d5jcbd1, d5jcbe_, d5jcbf1, d5jcbf2
    automated match to d4i50a2
    complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg

Details for d5jcbc2

PDB Entry: 5jcb (more details), 2.3 Å

PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5jcbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcbc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5jcbc2:

Click to download the PDB-style file with coordinates for d5jcbc2.
(The format of our PDB-style files is described here.)

Timeline for d5jcbc2: